Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VHL monoclonal antibody (M01), clone 1G12
Abnova
VHL monoclonal antibody (M01), clone 1G12
Ref: AB-H00007428-M01
VHL monoclonal antibody (M01), clone 1G12
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant VHL.
Información adicional
Size
100 ug
Gene Name
VHL
Gene Alias
HRCA1|RCA1|VHL1
Gene Description
von Hippel-Lindau tumor suppressor
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VHL (NP_000542, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7428
Clone Number
1G12
Iso type
IgG2b Kappa
Enviar uma mensagem
VHL monoclonal antibody (M01), clone 1G12
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*