VEGFB polyclonal antibody (A02)
  • VEGFB polyclonal antibody (A02)

VEGFB polyclonal antibody (A02)

Ref: AB-H00007423-A02
VEGFB polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VEGFB.
Información adicional
Size 50 uL
Gene Name VEGFB
Gene Alias VEGFL|VRF
Gene Description vascular endothelial growth factor B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VEGFB (NP_003368, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7423

Enviar uma mensagem


VEGFB polyclonal antibody (A02)

VEGFB polyclonal antibody (A02)