View larger
Mouse monoclonal antibody raised against a full length recombinant VCL.
AB-H00007414-M01
New product
VCL monoclonal antibody (M01), clone 2C6-1B5
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | VCL |
| Gene Alias | CMD1W|MVCL |
| Gene Description | vinculin |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA,IF |
| Immunogen Prot. Seq | MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTLEKMSAEINEIIRVLQLTSWDE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | VCL (AAH39174.1, 1 a.a. ~ 1066 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 7414 |
| Clone Number | 2C6-1B5 |
| Iso type | IgG1 kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant VCL.