VARS polyclonal antibody (A01)
  • VARS polyclonal antibody (A01)

VARS polyclonal antibody (A01)

Ref: AB-H00007407-A01
VARS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VARS.
Información adicional
Size 50 uL
Gene Name VARS
Gene Alias G7A|VARS1|VARS2
Gene Description valyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AVRLSNQGFQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMPQAPPSLCVTPYPEPSECSWKDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VARS (NP_006286, 994 a.a. ~ 1102 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7407

Enviar uma mensagem


VARS polyclonal antibody (A01)

VARS polyclonal antibody (A01)