USP1 purified MaxPab mouse polyclonal antibody (B01P)
  • USP1 purified MaxPab mouse polyclonal antibody (B01P)

USP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007398-B01P
USP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human USP1 protein.
Información adicional
Size 50 ug
Gene Name USP1
Gene Alias UBP
Gene Description ubiquitin specific peptidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQVVPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP1 (NP_003359.3, 1 a.a. ~ 785 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7398

Enviar uma mensagem


USP1 purified MaxPab mouse polyclonal antibody (B01P)

USP1 purified MaxPab mouse polyclonal antibody (B01P)