UROD purified MaxPab mouse polyclonal antibody (B02P)
  • UROD purified MaxPab mouse polyclonal antibody (B02P)

UROD purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00007389-B02P
UROD purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UROD protein.
Información adicional
Size 50 ug
Gene Name UROD
Gene Alias PCT
Gene Description uroporphyrinogen decarboxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UROD (AAH01778.1, 1 a.a. ~ 367 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7389

Enviar uma mensagem


UROD purified MaxPab mouse polyclonal antibody (B02P)

UROD purified MaxPab mouse polyclonal antibody (B02P)