UQCRH monoclonal antibody (M02), clone 1D7
  • UQCRH monoclonal antibody (M02), clone 1D7

UQCRH monoclonal antibody (M02), clone 1D7

Ref: AB-H00007388-M02
UQCRH monoclonal antibody (M02), clone 1D7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UQCRH.
Información adicional
Size 100 ug
Gene Name UQCRH
Gene Alias MGC111572|QCR6
Gene Description ubiquinol-cytochrome c reductase hinge protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UQCRH (AAH15177, 1 a.a. ~ 91 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7388
Clone Number 1D7
Iso type IgG2a Kappa

Enviar uma mensagem


UQCRH monoclonal antibody (M02), clone 1D7

UQCRH monoclonal antibody (M02), clone 1D7