UQCRH polyclonal antibody (A01)
  • UQCRH polyclonal antibody (A01)

UQCRH polyclonal antibody (A01)

Ref: AB-H00007388-A01
UQCRH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant UQCRH.
Información adicional
Size 50 uL
Gene Name UQCRH
Gene Alias MGC111572|QCR6
Gene Description ubiquinol-cytochrome c reductase hinge protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UQCRH (AAH15177, 1 a.a. ~ 91 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7388

Enviar uma mensagem


UQCRH polyclonal antibody (A01)

UQCRH polyclonal antibody (A01)