UQCRC2 purified MaxPab rabbit polyclonal antibody (D01P)
  • UQCRC2 purified MaxPab rabbit polyclonal antibody (D01P)

UQCRC2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007385-D01P
UQCRC2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UQCRC2 protein.
Información adicional
Size 100 ug
Gene Name UQCRC2
Gene Alias QCR2|UQCR2
Gene Description ubiquinol-cytochrome c reductase core protein II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UQCRC2 (NP_003357.2, 1 a.a. ~ 453 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7385

Enviar uma mensagem


UQCRC2 purified MaxPab rabbit polyclonal antibody (D01P)

UQCRC2 purified MaxPab rabbit polyclonal antibody (D01P)