UQCRC2 polyclonal antibody (A01)
  • UQCRC2 polyclonal antibody (A01)

UQCRC2 polyclonal antibody (A01)

Ref: AB-H00007385-A01
UQCRC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UQCRC2.
Información adicional
Size 50 uL
Gene Name UQCRC2
Gene Alias QCR2|UQCR2
Gene Description ubiquinol-cytochrome c reductase core protein II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UQCRC2 (NP_003357, 92 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7385

Enviar uma mensagem


UQCRC2 polyclonal antibody (A01)

UQCRC2 polyclonal antibody (A01)