UNG purified MaxPab rabbit polyclonal antibody (D01P)
  • UNG purified MaxPab rabbit polyclonal antibody (D01P)

UNG purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007374-D01P
UNG purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UNG protein.
Información adicional
Size 100 ug
Gene Name UNG
Gene Alias DGU|DKFZp781L1143|HIGM4|UDG|UNG1|UNG15|UNG2
Gene Description uracil-DNA glycosylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UNG (NP_003353.1, 1 a.a. ~ 304 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7374

Enviar uma mensagem


UNG purified MaxPab rabbit polyclonal antibody (D01P)

UNG purified MaxPab rabbit polyclonal antibody (D01P)