COL14A1 polyclonal antibody (A01)
  • COL14A1 polyclonal antibody (A01)

COL14A1 polyclonal antibody (A01)

Ref: AB-H00007373-A01
COL14A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COL14A1.
Información adicional
Size 50 uL
Gene Name COL14A1
Gene Alias UND
Gene Description collagen, type XIV, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TRLRYNVISHDSIQISWKAPRGKFGGYKLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL14A1 (NP_066933, 34 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7373

Enviar uma mensagem


COL14A1 polyclonal antibody (A01)

COL14A1 polyclonal antibody (A01)