UMPS polyclonal antibody (A01)
  • UMPS polyclonal antibody (A01)

UMPS polyclonal antibody (A01)

Ref: AB-H00007372-A01
UMPS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UMPS.
Información adicional
Size 50 uL
Gene Name UMPS
Gene Alias OPRT
Gene Description uridine monophosphate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UMPS (NP_000364, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7372

Enviar uma mensagem


UMPS polyclonal antibody (A01)

UMPS polyclonal antibody (A01)