UCK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • UCK2 purified MaxPab rabbit polyclonal antibody (D01P)

UCK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007371-D01P
UCK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UCK2 protein.
Información adicional
Size 100 ug
Gene Name UCK2
Gene Alias TSA903|UK|UMPK
Gene Description uridine-cytidine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UCK2 (NP_036606.2, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7371

Enviar uma mensagem


UCK2 purified MaxPab rabbit polyclonal antibody (D01P)

UCK2 purified MaxPab rabbit polyclonal antibody (D01P)