UGT8 polyclonal antibody (A01)
  • UGT8 polyclonal antibody (A01)

UGT8 polyclonal antibody (A01)

Ref: AB-H00007368-A01
UGT8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UGT8.
Información adicional
Size 50 uL
Gene Name UGT8
Gene Alias CGT
Gene Description UDP glycosyltransferase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGT8 (NP_003351, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7368

Enviar uma mensagem


UGT8 polyclonal antibody (A01)

UGT8 polyclonal antibody (A01)