UGT2B10 polyclonal antibody (A01)
  • UGT2B10 polyclonal antibody (A01)

UGT2B10 polyclonal antibody (A01)

Ref: AB-H00007365-A01
UGT2B10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UGT2B10.
Información adicional
Size 50 uL
Gene Name UGT2B10
Gene Alias MGC142209
Gene Description UDP glucuronosyltransferase 2 family, polypeptide B10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGT2B10 (NP_001066, 62 a.a. ~ 159 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7365

Enviar uma mensagem


UGT2B10 polyclonal antibody (A01)

UGT2B10 polyclonal antibody (A01)