UGT2B4 monoclonal antibody (M01), clone 2H6
  • UGT2B4 monoclonal antibody (M01), clone 2H6

UGT2B4 monoclonal antibody (M01), clone 2H6

Ref: AB-H00007363-M01
UGT2B4 monoclonal antibody (M01), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UGT2B4.
Información adicional
Size 100 ug
Gene Name UGT2B4
Gene Alias UGT2B11
Gene Description UDP glucuronosyltransferase 2 family, polypeptide B4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGT2B4 (NP_066962.1, 25 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7363
Clone Number 2H6
Iso type IgG2a Kappa

Enviar uma mensagem


UGT2B4 monoclonal antibody (M01), clone 2H6

UGT2B4 monoclonal antibody (M01), clone 2H6