UCP1 polyclonal antibody (A01)
  • UCP1 polyclonal antibody (A01)

UCP1 polyclonal antibody (A01)

Ref: AB-H00007350-A01
UCP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UCP1.
Información adicional
Size 50 uL
Gene Name UCP1
Gene Alias SLC25A7|UCP
Gene Description uncoupling protein 1 (mitochondrial, proton carrier)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UCP1 (NP_068605, 232 a.a. ~ 267 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7350

Enviar uma mensagem


UCP1 polyclonal antibody (A01)

UCP1 polyclonal antibody (A01)