UCHL3 monoclonal antibody (M01), clone 4E9
  • UCHL3 monoclonal antibody (M01), clone 4E9

UCHL3 monoclonal antibody (M01), clone 4E9

Ref: AB-H00007347-M01
UCHL3 monoclonal antibody (M01), clone 4E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UCHL3.
Información adicional
Size 100 ug
Gene Name UCHL3
Gene Alias UCH-L3
Gene Description ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UCHL3 (NP_005993, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7347
Clone Number 4E9
Iso type IgG2a Kappa

Enviar uma mensagem


UCHL3 monoclonal antibody (M01), clone 4E9

UCHL3 monoclonal antibody (M01), clone 4E9