UBE2N polyclonal antibody (A01)
  • UBE2N polyclonal antibody (A01)

UBE2N polyclonal antibody (A01)

Ref: AB-H00007334-A01
UBE2N polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant UBE2N.
Información adicional
Size 50 uL
Gene Name UBE2N
Gene Alias MGC131857|MGC8489|UBC13|UbcH-ben
Gene Description ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2N (AAH03365, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7334

Enviar uma mensagem


UBE2N polyclonal antibody (A01)

UBE2N polyclonal antibody (A01)