UBE2H monoclonal antibody (M01A), clone S2
  • UBE2H monoclonal antibody (M01A), clone S2

UBE2H monoclonal antibody (M01A), clone S2

Ref: AB-H00007328-M01A
UBE2H monoclonal antibody (M01A), clone S2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBE2H.
Información adicional
Size 200 uL
Gene Name UBE2H
Gene Alias E2-20K|UBC8|UBCH|UBCH2
Gene Description ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2H (AAH06277, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 7328
Clone Number S2
Iso type IgG2a Kappa

Enviar uma mensagem


UBE2H monoclonal antibody (M01A), clone S2

UBE2H monoclonal antibody (M01A), clone S2