UBE2G1 MaxPab mouse polyclonal antibody (B01P)
  • UBE2G1 MaxPab mouse polyclonal antibody (B01P)

UBE2G1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007326-B01P
UBE2G1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBE2G1 protein.
Información adicional
Size 50 ug
Gene Name UBE2G1
Gene Alias E217K|UBC7|UBE2G
Gene Description ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2G1 (NP_003333.1, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7326

Enviar uma mensagem


UBE2G1 MaxPab mouse polyclonal antibody (B01P)

UBE2G1 MaxPab mouse polyclonal antibody (B01P)