UBE2D3 monoclonal antibody (M03), clone S2
  • UBE2D3 monoclonal antibody (M03), clone S2

UBE2D3 monoclonal antibody (M03), clone S2

Ref: AB-H00007323-M03
UBE2D3 monoclonal antibody (M03), clone S2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBE2D3.
Información adicional
Size 100 ug
Gene Name UBE2D3
Gene Alias E2(17)KB3|MGC43926|MGC5416|UBC4/5|UBCH5C
Gene Description ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7323
Clone Number S2
Iso type IgG1 Kappa

Enviar uma mensagem


UBE2D3 monoclonal antibody (M03), clone S2

UBE2D3 monoclonal antibody (M03), clone S2