UBE2D1 monoclonal antibody (M01), clone 2C6
  • UBE2D1 monoclonal antibody (M01), clone 2C6

UBE2D1 monoclonal antibody (M01), clone 2C6

Ref: AB-H00007321-M01
UBE2D1 monoclonal antibody (M01), clone 2C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE2D1.
Información adicional
Size 100 ug
Gene Name UBE2D1
Gene Alias E2(17)KB1|SFT|UBC4/5|UBCH5|UBCH5A
Gene Description ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7321
Clone Number 2C6
Iso type IgG2a Kappa

Enviar uma mensagem


UBE2D1 monoclonal antibody (M01), clone 2C6

UBE2D1 monoclonal antibody (M01), clone 2C6