UBA52 polyclonal antibody (A01)
  • UBA52 polyclonal antibody (A01)

UBA52 polyclonal antibody (A01)

Ref: AB-H00007311-A01
UBA52 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBA52.
Información adicional
Size 50 uL
Gene Name UBA52
Gene Alias CEP52|HUBCEP52|MGC126879|MGC126881|MGC57125|RPL40
Gene Description ubiquitin A-52 residue ribosomal protein fusion product 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBA52 (NP_003324, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7311

Enviar uma mensagem


UBA52 polyclonal antibody (A01)

UBA52 polyclonal antibody (A01)