TYRO3 polyclonal antibody (A01)
  • TYRO3 polyclonal antibody (A01)

TYRO3 polyclonal antibody (A01)

Ref: AB-H00007301-A01
TYRO3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TYRO3.
Información adicional
Size 50 uL
Gene Name TYRO3
Gene Alias BYK|Brt|Dtk|FLJ16467|RSE|Sky|Tif
Gene Description TYRO3 protein tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TYRO3 (AAH49368, 50 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7301

Enviar uma mensagem


TYRO3 polyclonal antibody (A01)

TYRO3 polyclonal antibody (A01)