TYMS purified MaxPab rabbit polyclonal antibody (D01P)
  • TYMS purified MaxPab rabbit polyclonal antibody (D01P)

TYMS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007298-D01P
TYMS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TYMS protein.
Información adicional
Size 100 ug
Gene Name TYMS
Gene Alias HsT422|MGC88736|TMS|TS|TSase
Gene Description thymidylate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TYMS (AAH13919.1, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7298

Enviar uma mensagem


TYMS purified MaxPab rabbit polyclonal antibody (D01P)

TYMS purified MaxPab rabbit polyclonal antibody (D01P)