TYMS polyclonal antibody (A01)
  • TYMS polyclonal antibody (A01)

TYMS polyclonal antibody (A01)

Ref: AB-H00007298-A01
TYMS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TYMS.
Información adicional
Size 50 uL
Gene Name TYMS
Gene Alias HsT422|MGC88736|TMS|TS|TSase
Gene Description thymidylate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TYMS (AAH13919, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7298

Enviar uma mensagem


TYMS polyclonal antibody (A01)

TYMS polyclonal antibody (A01)