TYK2 monoclonal antibody (M03), clone 6H1
  • TYK2 monoclonal antibody (M03), clone 6H1

TYK2 monoclonal antibody (M03), clone 6H1

Ref: AB-H00007297-M03
TYK2 monoclonal antibody (M03), clone 6H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TYK2.
Información adicional
Size 100 ug
Gene Name TYK2
Gene Alias JTK1
Gene Description tyrosine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TYK2 (AAH14243, 276 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7297
Clone Number 6H1
Iso type IgG2a Kappa

Enviar uma mensagem


TYK2 monoclonal antibody (M03), clone 6H1

TYK2 monoclonal antibody (M03), clone 6H1