TXN purified MaxPab rabbit polyclonal antibody (D01P)
  • TXN purified MaxPab rabbit polyclonal antibody (D01P)

TXN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007295-D01P
TXN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TXN protein.
Información adicional
Size 100 ug
Gene Name TXN
Gene Alias DKFZp686B1993|MGC61975|TRX|TRX1
Gene Description thioredoxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TXN (NP_003320.2, 1 a.a. ~ 105 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7295

Enviar uma mensagem


TXN purified MaxPab rabbit polyclonal antibody (D01P)

TXN purified MaxPab rabbit polyclonal antibody (D01P)