TXN polyclonal antibody (A01)
  • TXN polyclonal antibody (A01)

TXN polyclonal antibody (A01)

Ref: AB-H00007295-A01
TXN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TXN.
Información adicional
Size 50 uL
Gene Name TXN
Gene Alias DKFZp686B1993|MGC61975|TRX|TRX1
Gene Description thioredoxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TXN (AAH03377, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7295

Enviar uma mensagem


TXN polyclonal antibody (A01)

TXN polyclonal antibody (A01)