TULP2 MaxPab rabbit polyclonal antibody (D01)
  • TULP2 MaxPab rabbit polyclonal antibody (D01)

TULP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007288-D01
TULP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TULP2 protein.
Información adicional
Size 100 uL
Gene Name TULP2
Gene Alias TUBL2
Gene Description tubby like protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSCLREERLLGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLGLQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDSDHMRH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TULP2 (AAH26070.1, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7288

Enviar uma mensagem


TULP2 MaxPab rabbit polyclonal antibody (D01)

TULP2 MaxPab rabbit polyclonal antibody (D01)