TTPA monoclonal antibody (M01), clone 7B5
  • TTPA monoclonal antibody (M01), clone 7B5

TTPA monoclonal antibody (M01), clone 7B5

Ref: AB-H00007274-M01
TTPA monoclonal antibody (M01), clone 7B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTPA.
Información adicional
Size 50 ug
Gene Name TTPA
Gene Alias ATTP|AVED|TTP1|alphaTTP
Gene Description tocopherol (alpha) transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTPA (NP_000361.1, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7274
Clone Number 7B5
Iso type IgG2a Kappa

Enviar uma mensagem


TTPA monoclonal antibody (M01), clone 7B5

TTPA monoclonal antibody (M01), clone 7B5