TTC3 polyclonal antibody (A01)
  • TTC3 polyclonal antibody (A01)

TTC3 polyclonal antibody (A01)

Ref: AB-H00007267-A01
TTC3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TTC3.
Información adicional
Size 50 uL
Gene Name TTC3
Gene Alias DCRR1|DKFZp686M0150|RNF105|TPRDIII
Gene Description tetratricopeptide repeat domain 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTC3 (NP_003307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7267

Enviar uma mensagem


TTC3 polyclonal antibody (A01)

TTC3 polyclonal antibody (A01)