DNAJC7 purified MaxPab rabbit polyclonal antibody (D01P)
  • DNAJC7 purified MaxPab rabbit polyclonal antibody (D01P)

DNAJC7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007266-D01P
DNAJC7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DNAJC7 protein.
Información adicional
Size 100 ug
Gene Name DNAJC7
Gene Alias DANJC7|DJ11|TPR2|TTC2
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNAJC7 (NP_003306.1, 1 a.a. ~ 484 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7266

Enviar uma mensagem


DNAJC7 purified MaxPab rabbit polyclonal antibody (D01P)

DNAJC7 purified MaxPab rabbit polyclonal antibody (D01P)