TTC1 monoclonal antibody (M01), clone 4E3
  • TTC1 monoclonal antibody (M01), clone 4E3

TTC1 monoclonal antibody (M01), clone 4E3

Ref: AB-H00007265-M01
TTC1 monoclonal antibody (M01), clone 4E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTC1.
Información adicional
Size 100 ug
Gene Name TTC1
Gene Alias FLJ46404|TPR1
Gene Description tetratricopeptide repeat domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq LRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTC1 (NP_003305, 193 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7265
Clone Number 4E3
Iso type IgG2b Kappa

Enviar uma mensagem


TTC1 monoclonal antibody (M01), clone 4E3

TTC1 monoclonal antibody (M01), clone 4E3