TSTA3 purified MaxPab mouse polyclonal antibody (B01P)
  • TSTA3 purified MaxPab mouse polyclonal antibody (B01P)

TSTA3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007264-B01P
TSTA3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TSTA3 protein.
Información adicional
Size 50 ug
Gene Name TSTA3
Gene Alias FX|P35B|SDR4E1
Gene Description tissue specific transplantation antigen P35B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSTA3 (NP_003304.1, 1 a.a. ~ 321 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7264

Enviar uma mensagem


TSTA3 purified MaxPab mouse polyclonal antibody (B01P)

TSTA3 purified MaxPab mouse polyclonal antibody (B01P)