TSPY1 monoclonal antibody (M01), clone 6G5
  • TSPY1 monoclonal antibody (M01), clone 6G5

TSPY1 monoclonal antibody (M01), clone 6G5

Ref: AB-H00007258-M01
TSPY1 monoclonal antibody (M01), clone 6G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TSPY1.
Información adicional
Size 100 ug
Gene Name TSPY1
Gene Alias DYS14|TSPY|pJA923
Gene Description testis specific protein, Y-linked 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPY1 (NP_003299, 201 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7258
Clone Number 6G5
Iso type IgG2a Kappa

Enviar uma mensagem


TSPY1 monoclonal antibody (M01), clone 6G5

TSPY1 monoclonal antibody (M01), clone 6G5