TSPY1 polyclonal antibody (A01)
  • TSPY1 polyclonal antibody (A01)

TSPY1 polyclonal antibody (A01)

Ref: AB-H00007258-A01
TSPY1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSPY1.
Información adicional
Size 50 uL
Gene Name TSPY1
Gene Alias DYS14|TSPY|pJA923
Gene Description testis specific protein, Y-linked 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPY1 (NP_003299, 201 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7258

Enviar uma mensagem


TSPY1 polyclonal antibody (A01)

TSPY1 polyclonal antibody (A01)