TSG101 MaxPab rabbit polyclonal antibody (D01)
  • TSG101 MaxPab rabbit polyclonal antibody (D01)

TSG101 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007251-D01
TSG101 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TSG101 protein.
Información adicional
Size 100 uL
Gene Name TSG101
Gene Alias TSG10|VPS23
Gene Description tumor susceptibility gene 101
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSG101 (ENSP00000251968, 1 a.a. ~ 390 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7251

Enviar uma mensagem


TSG101 MaxPab rabbit polyclonal antibody (D01)

TSG101 MaxPab rabbit polyclonal antibody (D01)