TSG101 purified MaxPab mouse polyclonal antibody (B01P)
  • TSG101 purified MaxPab mouse polyclonal antibody (B01P)

TSG101 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007251-B01P
TSG101 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TSG101 protein.
Información adicional
Size 50 ug
Gene Name TSG101
Gene Alias TSG10|VPS23
Gene Description tumor susceptibility gene 101
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSG101 (ENSP00000251968, 1 a.a. ~ 390 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7251

Enviar uma mensagem


TSG101 purified MaxPab mouse polyclonal antibody (B01P)

TSG101 purified MaxPab mouse polyclonal antibody (B01P)