TSC2 polyclonal antibody (A01)
  • TSC2 polyclonal antibody (A01)

TSC2 polyclonal antibody (A01)

Ref: AB-H00007249-A01
TSC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSC2.
Información adicional
Size 50 uL
Gene Name TSC2
Gene Alias FLJ43106|LAM|TSC4
Gene Description tuberous sclerosis 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLFLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSC2 (NP_000539, 540 a.a. ~ 658 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7249

Enviar uma mensagem


TSC2 polyclonal antibody (A01)

TSC2 polyclonal antibody (A01)