TRPC5 monoclonal antibody (M10), clone 1C8
  • TRPC5 monoclonal antibody (M10), clone 1C8

TRPC5 monoclonal antibody (M10), clone 1C8

Ref: AB-H00007224-M10
TRPC5 monoclonal antibody (M10), clone 1C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRPC5.
Información adicional
Size 100 ug
Gene Name TRPC5
Gene Alias TRP5
Gene Description transient receptor potential cation channel, subfamily C, member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPC5 (NP_036603, 534 a.a. ~ 603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7224
Clone Number 1C8
Iso type IgG2a Kappa

Enviar uma mensagem


TRPC5 monoclonal antibody (M10), clone 1C8

TRPC5 monoclonal antibody (M10), clone 1C8