TRPC5 purified MaxPab mouse polyclonal antibody (B01P)
  • TRPC5 purified MaxPab mouse polyclonal antibody (B01P)

TRPC5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007224-B01P
TRPC5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRPC5 protein.
Información adicional
Size 50 ug
Gene Name TRPC5
Gene Alias TRP5
Gene Description transient receptor potential cation channel, subfamily C, member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRPC5 (NP_036603.1, 1 a.a. ~ 973 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7224

Enviar uma mensagem


TRPC5 purified MaxPab mouse polyclonal antibody (B01P)

TRPC5 purified MaxPab mouse polyclonal antibody (B01P)