TRIP6 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIP6 purified MaxPab mouse polyclonal antibody (B01P)

TRIP6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007205-B01P
TRIP6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIP6 protein.
Información adicional
Size 50 ug
Gene Name TRIP6
Gene Alias MGC10556|MGC10558|MGC29959|MGC3837|MGC4423|OIP1|ZRP-1
Gene Description thyroid hormone receptor interactor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIP6 (NP_003293.2, 1 a.a. ~ 476 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7205

Enviar uma mensagem


TRIP6 purified MaxPab mouse polyclonal antibody (B01P)

TRIP6 purified MaxPab mouse polyclonal antibody (B01P)