TRIP6 polyclonal antibody (A02)
  • TRIP6 polyclonal antibody (A02)

TRIP6 polyclonal antibody (A02)

Ref: AB-H00007205-A02
TRIP6 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIP6.
Información adicional
Size 50 uL
Gene Name TRIP6
Gene Alias MGC10556|MGC10558|MGC29959|MGC3837|MGC4423|OIP1|ZRP-1
Gene Description thyroid hormone receptor interactor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIP6 (NP_003293, 51 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7205

Enviar uma mensagem


TRIP6 polyclonal antibody (A02)

TRIP6 polyclonal antibody (A02)