TRIO polyclonal antibody (A01)
  • TRIO polyclonal antibody (A01)

TRIO polyclonal antibody (A01)

Ref: AB-H00007204-A01
TRIO polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIO.
Información adicional
Size 50 uL
Gene Name TRIO
Gene Alias FLJ42780|tgat
Gene Description triple functional domain (PTPRF interacting)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIAYCQNKPKSEH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIO (NP_009049, 1961 a.a. ~ 2070 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7204

Enviar uma mensagem


TRIO polyclonal antibody (A01)

TRIO polyclonal antibody (A01)