TRAF5 purified MaxPab rabbit polyclonal antibody (D01P)
  • TRAF5 purified MaxPab rabbit polyclonal antibody (D01P)

TRAF5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007188-D01P
TRAF5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRAF5 protein.
Información adicional
Size 100 ug
Gene Name TRAF5
Gene Alias MGC:39780|RNF84
Gene Description TNF receptor-associated factor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRAF5 (NP_001029082.1, 1 a.a. ~ 557 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7188

Enviar uma mensagem


TRAF5 purified MaxPab rabbit polyclonal antibody (D01P)

TRAF5 purified MaxPab rabbit polyclonal antibody (D01P)