NR2C2 purified MaxPab mouse polyclonal antibody (B01P)
  • NR2C2 purified MaxPab mouse polyclonal antibody (B01P)

NR2C2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007182-B01P
NR2C2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NR2C2 protein.
Información adicional
Size 50 ug
Gene Name NR2C2
Gene Alias TAK1|TR2R1|TR4|hTAK1
Gene Description nuclear receptor subfamily 2, group C, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MTSPSPRIQIISTDSAVASPQRIQGSEPASGPLSVFTSLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQFTLTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSKRKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NR2C2 (AAH51670.1, 1 a.a. ~ 530 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7182

Enviar uma mensagem


NR2C2 purified MaxPab mouse polyclonal antibody (B01P)

NR2C2 purified MaxPab mouse polyclonal antibody (B01P)