NR2C1 polyclonal antibody (A01)
  • NR2C1 polyclonal antibody (A01)

NR2C1 polyclonal antibody (A01)

Ref: AB-H00007181-A01
NR2C1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NR2C1.
Información adicional
Size 50 uL
Gene Name NR2C1
Gene Alias TR2
Gene Description nuclear receptor subfamily 2, group C, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKASGRH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR2C1 (NP_003288, 17 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7181

Enviar uma mensagem


NR2C1 polyclonal antibody (A01)

NR2C1 polyclonal antibody (A01)